DNAAF2 anticorps (N-Term)

N° du produit ABIN632937

Détail du produit anti-DNAAF2 anticorps

Antigène: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DNAAF2 est non-conjugé

Application: Western Blotting (WB)

Specificité: C14 ORF104 antibody was raised against the N terminal Of C14 rf104

Purification: Affinity purified

Immunogène: C14 ORF104 antibody was raised using the N terminal Of C14 rf104 corresponding to a region with amino acids MFSQYAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C14ORF104 Blocking Peptide, catalog no. 33R-6005, is also available for use as a blocking control in assays to test for specificity of this C14ORF104 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF104 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DNAAF2

Antigène: DNAAF2 (C14orf104) (Chromosome 14 Open Reading Frame 104 (C14orf104))

Autre désignation: C14ORF104 (C14orf104 Produits)

Synonymes: anticorps 1110034A24Rik, anticorps 2810020C19Rik, anticorps AV032410, anticorps Ktu, anticorps TU54, anticorps mknt, anticorps C14orf104, anticorps CILD10, anticorps KTU, anticorps PF13, anticorps C10H14orf104, anticorps RGD1310311, anticorps c14orf104, anticorps cild10, anticorps kintoun, anticorps ktu, anticorps zgc:110294, anticorps dynein axonemal assembly factor 2, anticorps dynein, axonemal assembly factor 2, anticorps dynein, axonemal, assembly factor 2, anticorps dynein, axonemal, assembly factor 2 L homeolog, anticorps DNAAF2, anticorps Dnaaf2, anticorps dnaaf2.L, anticorps dnaaf2

Sujet: This protein is highly conserved and involved in the preassembly of dynein arm complexes which power cilia. These complexes are found in some cilia and are assembled in the cytoplasm prior to transport for cilia formation. Mutations in this gene have been associated with primary ciliary dyskinesia. Multiple transcript variants encoding different isoforms have been found for this gene.

Poids moléculaire: 91 kDa (MW of target protein)