SMG8 anticorps (Middle Region)

N° du produit ABIN632938

Détail du produit anti-SMG8 anticorps

Antigène: SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMG8 est non-conjugé

Application: Western Blotting (WB)

Specificité: C17 ORF71 antibody was raised against the middle region of C17 rf71

Purification: Affinity purified

Immunogène: C17 ORF71 antibody was raised using the middle region of C17 rf71 corresponding to a region with amino acids HCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C17ORF71 Blocking Peptide, catalog no. 33R-3702, is also available for use as a blocking control in assays to test for specificity of this C17ORF71 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF71 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMG8

Antigène: SMG8 (Smg-8 Homolog, Nonsense Mediated mRNA Decay Factor (SMG8))

Autre désignation: C17ORF71 (SMG8 Produits)

Synonymes: anticorps C17orf71, anticorps 1200011M11Rik, anticorps C19H17orf71, anticorps SMG8, nonsense mediated mRNA decay factor, anticorps smg-8 homolog, nonsense mediated mRNA decay factor (C. elegans), anticorps Protein smg-8, anticorps SMG8, anticorps Smg8, anticorps smg-8

Sujet: The C17ORF71 protein is a component of the SMG1C complex, a mRNA surveillance complex that recognises and degrades mRNAs containing premature translation termination codons (PTCs) via the nonsense-mediated mRNA decay (NMD). The complex probably acts by associating with ribosomes during tranlation termination on mRNPs. If an exon junction complex (EJC) is located 50-55 or more nucleotides downstream from the termination codon, SMG1 phosphorylates UPF1/RENT1, triggering nonsense-mediated mRNA decay (NMD).

Poids moléculaire: 110 kDa (MW of target protein)