CCDC87 anticorps (N-Term)

N° du produit ABIN632942

Détail du produit anti-CCDC87 anticorps

Antigène: CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC87 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC87 antibody was raised against the N terminal of CCDC87

Purification: Affinity purified

Immunogène: CCDC87 antibody was raised using the N terminal of CCDC87 corresponding to a region with amino acids MMEPPKPEPELQRFYHRLLRPLSLFPTRTTSPEPQKRPPQEGRILQSFPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC87 Blocking Peptide, catalog no. 33R-6230, is also available for use as a blocking control in assays to test for specificity of this CCDC87 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC87 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC87

Antigène: CCDC87 (Coiled-Coil Domain Containing 87 (CCDC87))

Autre désignation: CCDC87 (CCDC87 Produits)

Synonymes: anticorps 4931419P11Rik, anticorps coiled-coil domain containing 87, anticorps CCDC87, anticorps Ccdc87

Sujet: The function of CCDC87 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 96 kDa (MW of target protein)