UFSP2 anticorps (Middle Region)

N° du produit ABIN632946

Cet anticorps anti-UFSP2 est un anticorps Lapin Polyclonal détectant UFSP2 dans WB. Adapté pour Humain.

Aperçu rapide pour UFSP2 anticorps (Middle Region) (ABIN632946)

Antigène: UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UFSP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UFSP2 anticorps

Épitope: Middle Region

Specificité: C4 ORF20 antibody was raised against the middle region of C4 rf20

Purification: Affinity purified

Immunogène: C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C4ORF20 Blocking Peptide, (ABIN936089), is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UFSP2

Antigène: UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))

Autre désignation: C4ORF20

Sujet: Ubiquitin-fold modifier-1 must be processed by a protease before it can conjugate with its target proteins. C4ORF20 is a thiol protease that specifically processes the C terminus of UFM1.

Poids moléculaire: 53 kDa (MW of target protein)