ARHGAP15 anticorps (Middle Region)

N° du produit ABIN632948

L’anticorps Lapin Polyclonal anti-ARHGAP15 a été validé pour WB. Il convient pour détecter ARHGAP15 dans des échantillons de Humain.

Aperçu rapide pour ARHGAP15 anticorps (Middle Region) (ABIN632948)

Antigène: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARHGAP15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ARHGAP15 anticorps

Épitope: Middle Region

Specificité: ARHGAP15 antibody was raised against the middle region of ARHGAP15

Purification: Affinity purified

Immunogène: ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARHGAP15 Blocking Peptide, (ABIN5612146), is also available for use as a blocking control in assays to test for specificity of this ARHGAP15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARHGAP15

Antigène: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Autre désignation: ARHGAP15

Sujet: RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15.

Poids moléculaire: 54 kDa (MW of target protein)