SASH3 anticorps (N-Term)

N° du produit ABIN632950

Détail du produit anti-SASH3 anticorps

Antigène: SASH3 (SAM and SH3 Domain Containing 3 (SASH3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SASH3 est non-conjugé

Application: Western Blotting (WB)

Specificité: CXORF9 antibody was raised against the N terminal Of Cxorf9

Purification: Affinity purified

Immunogène: CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CXORF9 Blocking Peptide, catalog no. 33R-4594, is also available for use as a blocking control in assays to test for specificity of this CXORF9 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CXORF9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SASH3

Antigène: SASH3 (SAM and SH3 Domain Containing 3 (SASH3))

Autre désignation: CXORF9 (SASH3 Produits)

Synonymes: anticorps 753P9, anticorps CXorf9, anticorps HACS2, anticorps SH3D6C, anticorps SLY, anticorps 1200013B08Rik, anticorps AW413946, anticorps SLY1, anticorps HXCXORF9, anticorps SAM and SH3 domain containing 3, anticorps SASH3, anticorps Sash3

Sujet: The CXORF9 protein contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response