PDXP anticorps

N° du produit ABIN632951

L’anticorps anti-PDXP Polyclonal Lapin est utilisé pour la détection de PDXP dans des échantillons de Souris et Humain. Il a été validé pour WB.

Aperçu rapide pour PDXP anticorps (ABIN632951)

Antigène: PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))

Reactivité: Souris, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDXP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDXP anticorps

Purification: Affinity purified

Immunogène: PDXP antibody was raised using a synthetic peptide corresponding to a region with amino acids DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDXP Blocking Peptide, (ABIN937508), is also available for use as a blocking control in assays to test for specificity of this PDXP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDXP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDXP

Antigène: PDXP (Pyridoxal (Pyridoxine, Vitamin B6) Phosphatase (PDXP))

Autre désignation: PDXP

Sujet: Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.

Poids moléculaire: 32 kDa (MW of target protein)