RAB22A anticorps (Middle Region)
-
- Antigène Voir toutes RAB22A Anticorps
- RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB22A est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAB22 A antibody was raised against the middle region of RAB22
- Purification
- Affinity purified
- Immunogène
- RAB22 A antibody was raised using the middle region of RAB22 corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS
- Top Product
- Discover our top product RAB22A Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAB22A Blocking Peptide, catalog no. 33R-3964, is also available for use as a blocking control in assays to test for specificity of this RAB22A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))
- Autre désignation
- RAB22A (RAB22A Produits)
- Synonymes
- anticorps 3732413A17Rik, anticorps AI662177, anticorps AW319644, anticorps AW550514, anticorps E130120E14Rik, anticorps Rab22, anticorps RAB22, anticorps RAB22A, member RAS oncogene family, anticorps Rab22a, anticorps RAB22A
- Sujet
- The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom
- Poids moléculaire
- 22 kDa (MW of target protein)
-