RAB22A anticorps (Middle Region)

N° du produit ABIN632952

Cet anticorps anti-RAB22A Polyclonal Lapin (ABIN632952) détecte spécifiquement RAB22A dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour RAB22A anticorps (Middle Region) (ABIN632952)

Antigène: RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB22A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAB22A anticorps

Épitope: Middle Region

Specificité: RAB22 A antibody was raised against the middle region of RAB22

Purification: Affinity purified

Immunogène: RAB22 A antibody was raised using the middle region of RAB22 corresponding to a region with amino acids IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB22A Blocking Peptide, (ABIN939350), is also available for use as a blocking control in assays to test for specificity of this RAB22A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB22A

Antigène: RAB22A (RAB22A, Member RAS Oncogene Family (RAB22A))

Autre désignation: RAB22A

Sujet: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

Poids moléculaire: 22 kDa (MW of target protein)