BTF3P13 anticorps (Middle Region)

N° du produit ABIN632957

L’anticorps Lapin Polyclonal anti-BTF3P13 a été validé pour WB. Il convient pour détecter BTF3P13 dans des échantillons de Humain.

Aperçu rapide pour BTF3P13 anticorps (Middle Region) (ABIN632957)

Antigène: BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BTF3P13 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BTF3P13 anticorps

Épitope: Middle Region

Specificité: BTF3 L3 antibody was raised against the middle region of BTF3 3

Purification: Affinity purified

Immunogène: BTF3 L3 antibody was raised using the middle region of BTF3 3 corresponding to a region with amino acids CRSTDHEPGKLAKLQAQVRIGGKGTAHRKKKVFHRTATADDKKLQFSLKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BTF3L3 Blocking Peptide, (ABIN937186), is also available for use as a blocking control in assays to test for specificity of this BTF3L3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BTF3P13

Antigène: BTF3P13 (Basic Transcription Factor 3 Pseudogene 13 (BTF3P13))

Autre désignation: BTF3L3

Sujet: BTF3L3 is a putative member of the BTF3 family of transcription factors and is thought to represent a pseudogene.

Poids moléculaire: 23 kDa (MW of target protein)