SCRN2 anticorps (N-Term)

N° du produit ABIN632961

Détail du produit anti-SCRN2 anticorps

Antigène: SCRN2 (Secernin 2 (SCRN2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCRN2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Secernin 2 antibody was raised against the N terminal of SCRN2

Purification: Affinity purified

Immunogène: Secernin 2 antibody was raised using the N terminal of SCRN2 corresponding to a region with amino acids MASSSPDSPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVFVPAGT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Secernin 2 Blocking Peptide, catalog no. 33R-5762, is also available for use as a blocking control in assays to test for specificity of this Secernin 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCRN2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCRN2

Antigène: SCRN2 (Secernin 2 (SCRN2))

Autre désignation: Secernin 2 (SCRN2 Produits)

Synonymes: anticorps MGC147610, anticorps si:ch211-184m19.2, anticorps Ses2, anticorps AV001119, anticorps D11Moh48, anticorps SES2, anticorps secernin 2, anticorps secernin 2 S homeolog, anticorps SCRN2, anticorps scrn2, anticorps scrn2.S, anticorps Scrn2

Sujet: The function of SCRN2 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 47 kDa (MW of target protein)