GLRX3 anticorps (N-Term)
-
- Antigène Voir toutes GLRX3 Anticorps
- GLRX3 (Glutaredoxin 3 (GLRX3))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GLRX3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GLRX3 antibody was raised against the N terminal of GLRX3
- Purification
- Affinity purified
- Immunogène
- GLRX3 antibody was raised using the N terminal of GLRX3 corresponding to a region with amino acids MEELLRRELGCSSVRATGHSGGGCISQGRSYDTDQGRVFVKVNPKAEARR
- Top Product
- Discover our top product GLRX3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GLRX3 Blocking Peptide, catalog no. 33R-5905, is also available for use as a blocking control in assays to test for specificity of this GLRX3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLRX3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GLRX3 (Glutaredoxin 3 (GLRX3))
- Autre désignation
- GLRX3 (GLRX3 Produits)
- Synonymes
- anticorps GLRX4, anticorps GRX3, anticorps GRX4, anticorps PICOT, anticorps TXNL2, anticorps TXNL3, anticorps Txnl2, anticorps txnl2, anticorps wu:fb38e09, anticorps zgc:103648, anticorps NME/NM23 family member 9, anticorps thioredoxin-like 2, anticorps glutaredoxin 3, anticorps NME9, anticorps LOC100285323, anticorps GLRX3, anticorps Glrx3, anticorps glrx3
- Sujet
- GLRX3 may play a role in regulating the function of the thioredoxin system.
- Poids moléculaire
- 37 kDa (MW of target protein)
- Pathways
- Cell RedoxHomeostasis
-