FBXO15 anticorps (N-Term)

N° du produit ABIN632966

L’anticorps Lapin Polyclonal anti-FBXO15 a été validé pour WB. Il convient pour détecter FBXO15 dans des échantillons de Humain et Rat.

Aperçu rapide pour FBXO15 anticorps (N-Term) (ABIN632966)

Antigène: FBXO15 (F-Box Protein 15 (FBXO15))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBXO15 anticorps

Épitope: N-Term

Specificité: FBXO15 antibody was raised against the N terminal of FBXO15

Purification: Affinity purified

Immunogène: FBXO15 antibody was raised using the N terminal of FBXO15 corresponding to a region with amino acids QDKEAGYWKKEYITKQIASVKAALADILKPVNPYTGLPVKTKEALRIFGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO15 Blocking Peptide, (ABIN5613535), is also available for use as a blocking control in assays to test for specificity of this FBXO15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO15

Antigène: FBXO15 (F-Box Protein 15 (FBXO15))

Autre désignation: FBXO15

Sujet: FBXO15 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO15, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Poids moléculaire: 49 kDa (MW of target protein)