IPP anticorps (C-Term)
-
- Antigène Voir toutes IPP Anticorps
- IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))
-
Épitope
- C-Term
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IPP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IPP antibody was raised against the C terminal of IPP
- Purification
- Affinity purified
- Immunogène
- IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAAL
- Top Product
- Discover our top product IPP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IPP Blocking Peptide, catalog no. 33R-2592, is also available for use as a blocking control in assays to test for specificity of this IPP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IPP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IPP (Intracisternal A Particle-Promoted Polypeptide (IPP))
- Autre désignation
- IPP (IPP Produits)
- Synonymes
- anticorps KLHL27, anticorps D4Jhu8, anticorps Mipp, anticorps klhl27, anticorps MGC80773, anticorps MGC136076, anticorps zgc:171487, anticorps intracisternal A particle-promoted polypeptide, anticorps IAP promoted placental gene, anticorps intracisternal A particle-promoted polypeptide L homeolog, anticorps IPP, anticorps Ipp, anticorps ipp.L, anticorps ipp
- Sujet
- IPP is a member of the kelch family of proteins, which is characterized by a 50 amino acid repeat which interacts with actin.
- Poids moléculaire
- 65 kDa (MW of target protein)
-