NT5C1B anticorps (N-Term)

N° du produit ABIN632978

Détail du produit anti-NT5C1B anticorps

Antigène: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NT5C1B est non-conjugé

Application: Western Blotting (WB)

Specificité: NT5 C5 antibody was raised against the N terminal of NT5 5

Purification: Affinity purified

Immunogène: NT5 C5 antibody was raised using the N terminal of NT5 5 corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NT5C1B Blocking Peptide, catalog no. 33R-6484, is also available for use as a blocking control in assays to test for specificity of this NT5C1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NT5C1B

Antigène: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Autre désignation: NT5C1B (NT5C1B Produits)

Synonymes: anticorps 4921514H13Rik, anticorps AIRP, anticorps CN-IB, anticorps Rdh14, anticorps CN1B, anticorps zgc:163054, anticorps 5'-nucleotidase, cytosolic IB, anticorps 5'-nucleotidase, cytosolic IB a, anticorps Nt5c1b, anticorps NT5C1B, anticorps nt5c1ba

Sujet: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.

Poids moléculaire: 61 kDa (MW of target protein)