NT5C1B anticorps (N-Term)

N° du produit ABIN632978

L’anticorps anti-NT5C1B Polyclonal Lapin est utilisé pour la détection de NT5C1B dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour NT5C1B anticorps (N-Term) (ABIN632978)

Antigène: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NT5C1B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NT5C1B anticorps

Épitope: N-Term

Specificité: NT5 C5 antibody was raised against the N terminal of NT5 5

Purification: Affinity purified

Immunogène: NT5 C5 antibody was raised using the N terminal of NT5 5 corresponding to a region with amino acids MSQTSLKQKKNEPGMRSSKESLEAEKRKESDKTGVRLSNQGSQESSLRKT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NT5C1B Blocking Peptide, (ABIN5615073), is also available for use as a blocking control in assays to test for specificity of this NT5C1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NT5C1B

Antigène: NT5C1B (5'-Nucleotidase, Cytosolic IB (NT5C1B))

Autre désignation: NT5C1B

Sujet: Cytosolic 5-prime nucleotidases, such as NT5C1B, catalyze production of adenosine, which regulates diverse physiologic processes.

Poids moléculaire: 61 kDa (MW of target protein)