DCK anticorps (Middle Region)

N° du produit ABIN632979

Détail du produit anti-DCK anticorps

Antigène: DCK (Deoxycytidine Kinase (DCK))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DCK est non-conjugé

Application: Western Blotting (WB)

Specificité: DCK antibody was raised against the middle region of DCK

Purification: Affinity purified

Immunogène: DCK antibody was raised using the middle region of DCK corresponding to a region with amino acids ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DCK Blocking Peptide, catalog no. 33R-1569, is also available for use as a blocking control in assays to test for specificity of this DCK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DCK

Antigène: DCK (Deoxycytidine Kinase (DCK))

Autre désignation: DCK (DCK Produits)

Synonymes: anticorps dck, anticorps DCK, anticorps wu:fc15f06, anticorps zgc:101771, anticorps dck1, anticorps deoxycytidine kinase, anticorps deoxycytidine kinase, gene 2 L homeolog, anticorps deoxycytidine kinase, gene 2, anticorps Deoxycytidine kinase, anticorps deoxycytidine kinase, gene 1 L homeolog, anticorps DCK, anticorps dck, anticorps dck.2.L, anticorps dck.2, anticorps Dck, anticorps FPV059, anticorps FPV151, anticorps dck.1.L

Sujet: Deoxycytidine kinase (DCK) is required for the phosphorylation of several deoxyribonucleosides and their nucleoside analogs. Deficiency of DCK is associated with resistance to antiviral and anticancer chemotherapeutic agents. Conversely, increased deoxycytidine kinase activity is associated with increased activation of these compounds to cytotoxic nucleoside triphosphate derivatives. DCK is clinically important because of its relationship to drug resistance and sensitivity.

Poids moléculaire: 30 kDa (MW of target protein)