C9orf43 anticorps (Middle Region)

N° du produit ABIN632984

Détail du produit anti-C9orf43 anticorps

Antigène: C9orf43 (Chromosome 9 Open Reading Frame 43 (C9orf43))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C9orf43 est non-conjugé

Application: Western Blotting (WB)

Specificité: C9 ORF43 antibody was raised against the middle region of C9 rf43

Purification: Affinity purified

Immunogène: C9 ORF43 antibody was raised using the middle region of C9 rf43 corresponding to a region with amino acids PEAQAARQKKISFNFSEIMASTGWNSELKLLRILQDTDDEDEEDQSSGAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C9ORF43 Blocking Peptide, catalog no. 33R-7032, is also available for use as a blocking control in assays to test for specificity of this C9ORF43 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF43 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C9orf43

Antigène: C9orf43 (Chromosome 9 Open Reading Frame 43 (C9orf43))

Autre désignation: C9ORF43 (C9orf43 Produits)

Synonymes: anticorps C9orf43, anticorps chromosome 9 open reading frame 43, anticorps chromosome 15 open reading frame, human C9orf43, anticorps C9orf43, anticorps C15H9orf43

Sujet: The function of the C9orf43 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 52 kDa (MW of target protein)