ZNF420 anticorps (N-Term)

N° du produit ABIN632987

Détail du produit anti-ZNF420 anticorps

Antigène: ZNF420 (Zinc Finger Protein 420 (ZNF420))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF420 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZNF420 antibody was raised against the N terminal of ZNF420

Purification: Affinity purified

Immunogène: ZNF420 antibody was raised using the N terminal of ZNF420 corresponding to a region with amino acids LENYSNLVSLDLPSRCASKDLSPEKNTYETELSQWEMSDRLENCDLEESN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZNF420 Blocking Peptide, catalog no. 33R-4917, is also available for use as a blocking control in assays to test for specificity of this ZNF420 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF420 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZNF420

Antigène: ZNF420 (Zinc Finger Protein 420 (ZNF420))

Autre désignation: ZNF420 (ZNF420 Produits)

Synonymes: anticorps APAK, anticorps B230119D13, anticorps B230312I18Rik, anticorps mszf59-1, anticorps mszf70, anticorps zinc finger protein 420, anticorps ZNF420, anticorps znf420, anticorps LOC713619, anticorps LOC100062389, anticorps LOC100346786, anticorps Zfp420

Sujet: ZNF420 contains 19 C2H2-type zinc fingers and 1 KRAB domain. ZNF420 may be involved in transcriptional regulation.

Poids moléculaire: 80 kDa (MW of target protein)