LACTB2 anticorps (Middle Region)

N° du produit ABIN632991

Détail du produit anti-LACTB2 anticorps

Antigène: LACTB2 (Lactamase, beta 2 (LACTB2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LACTB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: Beta Lactamase 2 antibody was raised against the middle region of LACTB2

Purification: Affinity purified

Immunogène: Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Beta Lactamase 2 Blocking Peptide, catalog no. 33R-6830, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase 2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LACTB2

Antigène: LACTB2 (Lactamase, beta 2 (LACTB2))

Abstract: LACTB2 Produits

Synonymes: anticorps Cgi-83, anticorps E430032H21Rik, anticorps lactb2, anticorps lactamase beta 2, anticorps lactamase beta 2 L homeolog, anticorps lactamase, beta 2, anticorps LACTB2, anticorps lactb2.L, anticorps Lactb2, anticorps lactb2

Sujet: The specific function of LACTB2 is not yet known.

Poids moléculaire: 33 kDa (MW of target protein)