LYSMD2 anticorps (Middle Region)

N° du produit ABIN632998

Détail du produit anti-LYSMD2 anticorps

Antigène: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LYSMD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LYSMD2 antibody was raised against the middle region of LYSMD2

Purification: Affinity purified

Immunogène: LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LYSMD2 Blocking Peptide, catalog no. 33R-9496, is also available for use as a blocking control in assays to test for specificity of this LYSMD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYSMD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LYSMD2

Antigène: LYSMD2 (LysM, Putative Peptidoglycan-Binding, Domain Containing 2 (LYSMD2))

Autre désignation: LYSMD2 (LYSMD2 Produits)

Synonymes: anticorps 2210402C18Rik, anticorps AV033872, anticorps AW538442, anticorps RGD1304585, anticorps zgc:91941, anticorps MGC108236, anticorps LysM, putative peptidoglycan-binding, domain containing 2, anticorps LysM domain containing 2, anticorps LysM, putative peptidoglycan-binding, domain containing 2 L homeolog, anticorps Lysmd2, anticorps LYSMD2, anticorps lysmd2.L, anticorps lysmd2

Sujet: The function of LYSMD2 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 23 kDa (MW of target protein)