PARP11 anticorps

N° du produit ABIN633008

L’anticorps anti-PARP11 Polyclonal produit chez le Lapin a été validé pour WB. Il convient pour la détection de PARP11 dans des échantillons provenant de Humain. }

Aperçu rapide pour PARP11 anticorps (ABIN633008)

Antigène: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PARP11 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PARP11 anticorps

Purification: Affinity purified

Immunogène: PARP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PARP11

Antigène: PARP11 (Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11))

Autre désignation: PARP11

Sujet: The PARP11 gene is part of the poly (ADP-ribose) polymerase family.

Poids moléculaire: 39 kDa (MW of target protein)