SFRS12 anticorps (N-Term)

N° du produit ABIN633011

L’anticorps Lapin Polyclonal anti-SFRS12 a été validé pour WB. Il convient pour détecter SFRS12 dans des échantillons de Humain.

Aperçu rapide pour SFRS12 anticorps (N-Term) (ABIN633011)

Antigène: SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS12 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SFRS12 anticorps

Épitope: N-Term

Specificité: SFRS12 antibody was raised against the N terminal of SFRS12

Purification: Affinity purified

Immunogène: SFRS12 antibody was raised using the N terminal of SFRS12 corresponding to a region with amino acids DPSSVGVAQHLTNTVFIDRALIVVPCAEGKIPEESKALSLLAPAPTMTSL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS12 Blocking Peptide, (ABIN937503), is also available for use as a blocking control in assays to test for specificity of this SFRS12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS12

Antigène: SFRS12 (SREK1) (Splicing Regulatory Glutamine/lysine-Rich Protein 1 (SREK1))

Autre désignation: SFRS12

Sujet: SFRS12 belongs to the superfamily of serine/arginine-rich (SR) splicing factors. It modulates splice site selection by regulating the activities of other SR proteins.

Poids moléculaire: 72 kDa (MW of target protein)