FAM78A anticorps (N-Term)

N° du produit ABIN633017

L’anticorps anti-FAM78A Polyclonal Lapin est utilisé pour la détection de FAM78A dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB.

Aperçu rapide pour FAM78A anticorps (N-Term) (ABIN633017)

Antigène: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAM78A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAM78A anticorps

Épitope: N-Term

Specificité: FAM78 A antibody was raised against the N terminal of FAM78

Purification: Affinity purified

Immunogène: FAM78 A antibody was raised using the N terminal of FAM78 corresponding to a region with amino acids MPGFFCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM78A Blocking Peptide, (ABIN5613503), is also available for use as a blocking control in assays to test for specificity of this FAM78A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM70 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAM78A

Antigène: FAM78A (Family with Sequence Similarity 78, Member A (FAM78A))

Autre désignation: FAM78A

Sujet: The function of FAM78A has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 32 kDa (MW of target protein)