S100PBP anticorps (Middle Region)

N° du produit ABIN633020

Détail du produit anti-S100PBP anticorps

Antigène: S100PBP (S100P Binding Protein (S100PBP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp S100PBP est non-conjugé

Application: Western Blotting (WB)

Specificité: S100 PBP antibody was raised against the middle region of S100 BP

Purification: Affinity purified

Immunogène: S100 PBP antibody was raised using the middle region of S100 BP corresponding to a region with amino acids ERRLGKVIPVLQTKTRTNVPTFSQSNLEQQKQLYLRSVIAHIEDPEDTNQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

S100PBP Blocking Peptide, catalog no. 33R-2713, is also available for use as a blocking control in assays to test for specificity of this S100PBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of S100 BP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur S100PBP

Antigène: S100PBP (S100P Binding Protein (S100PBP))

Autre désignation: S100PBP (S100PBP Produits)

Synonymes: anticorps s100pbpr, anticorps S100PBPR, anticorps 4930429A08Rik, anticorps AI851343, anticorps S100pbpr, anticorps RGD1564943, anticorps S100P binding protein, anticorps S100P binding protein L homeolog, anticorps S100PBP, anticorps s100pbp, anticorps S100pbp, anticorps s100pbp.L

Sujet: The function of S100PBP protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 37 kDa (MW of target protein)