Phosphoglucomutase 3 anticorps (N-Term)

N° du produit ABIN633023

L’anticorps Lapin Polyclonal anti-Phosphoglucomutase 3 a été validé pour WB. Il convient pour détecter Phosphoglucomutase 3 dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour Phosphoglucomutase 3 anticorps (N-Term) (ABIN633023)

Antigène: Phosphoglucomutase 3 (PGM3)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Phosphoglucomutase 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Phosphoglucomutase 3 anticorps

Épitope: N-Term

Specificité: PGM3 antibody was raised against the N terminal of PGM3

Purification: Affinity purified

Immunogène: PGM3 antibody was raised using the N terminal of PGM3 corresponding to a region with amino acids IDISEKEAVNLQQDAFVVIGRDTRPSSEKLSQSVIDGVTVLGGQFHDYGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PGM3 Blocking Peptide, (ABIN939303), is also available for use as a blocking control in assays to test for specificity of this PGM3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Phosphoglucomutase 3

Antigène: Phosphoglucomutase 3 (PGM3)

Autre désignation: PGM3

Sujet: PGM3 interconverts GlcNAc-6-P and GlcNAc-1-P.

Poids moléculaire: 60 kDa (MW of target protein)