APIP anticorps (Middle Region)

N° du produit ABIN633024

Détail du produit anti-APIP anticorps

Antigène: APIP (APAF1 Interacting Protein (APIP))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APIP est non-conjugé

Application: Western Blotting (WB)

Specificité: APIP antibody was raised against the middle region of APIP

Purification: Affinity purified

Immunogène: APIP antibody was raised using the middle region of APIP corresponding to a region with amino acids GIKKCTSGGYYRYDDMLVVPIIENTPEEKDLKDRMAHAMNEYPDSCAVLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

APIP Blocking Peptide, catalog no. 33R-3330, is also available for use as a blocking control in assays to test for specificity of this APIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur APIP

Antigène: APIP (APAF1 Interacting Protein (APIP))

Autre désignation: APIP (APIP Produits)

Synonymes: anticorps APIP2, anticorps CGI29, anticorps MMRP19, anticorps dJ179L10.2, anticorps hAPIP, anticorps CGI-29, anticorps Mmrp19, anticorps RGD1564562, anticorps zgc:103619, anticorps APAF1 interacting protein, anticorps APAF1 interacting protein S homeolog, anticorps APIP, anticorps Apip, anticorps apip, anticorps apip.S

Sujet: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Methionine Biosynthetic Process