PCGF1 anticorps (Middle Region)

N° du produit ABIN633027

Détail du produit anti-PCGF1 anticorps

Antigène: PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PCGF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: PCGF1 antibody was raised against the middle region of PCGF1

Purification: Affinity purified

Immunogène: PCGF1 antibody was raised using the middle region of PCGF1 corresponding to a region with amino acids PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PCGF1 Blocking Peptide, catalog no. 33R-6967, is also available for use as a blocking control in assays to test for specificity of this PCGF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PCGF1

Antigène: PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))

Autre désignation: PCGF1 (PCGF1 Produits)

Synonymes: anticorps PCGF1, anticorps 2010002K04Rik, anticorps NSPC1, anticorps RNF3A-2, anticorps RNF68, anticorps AU024121, anticorps Nspc1, anticorps nspc1, anticorps si:zc207o21.2, anticorps polycomb group ring finger 1, anticorps polycomb group ring finger 1 L homeolog, anticorps PCGF1, anticorps pcgf1, anticorps Pcgf1, anticorps pcgf1.L

Sujet: PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.

Poids moléculaire: 30 kDa (MW of target protein)