KRTAP23-1 anticorps (Middle Region)

N° du produit ABIN633028

Détail du produit anti-KRTAP23-1 anticorps

Antigène: KRTAP23-1 (Keratin Associated Protein 23-1 (KRTAP23-1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRTAP23-1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KAP23.1 antibody was raised against the middle region of KRTAP23-1

Purification: Affinity purified

Immunogène: KAP23.1 antibody was raised using the middle region of KRTAP23-1 corresponding to a region with amino acids CEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KAP23.1 Blocking Peptide, catalog no. 33R-1676, is also available for use as a blocking control in assays to test for specificity of this KAP23.1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRTAP23-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KRTAP23-1

Antigène: KRTAP23-1 (Keratin Associated Protein 23-1 (KRTAP23-1))

Autre désignation: KAP23.1 (KRTAP23-1 Produits)

Synonymes: anticorps KAP23.1, anticorps keratin associated protein 23-1, anticorps KRTAP23-1

Sujet: In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins.

Poids moléculaire: 7 kDa (MW of target protein)