LRRC3 anticorps (Middle Region)

N° du produit ABIN633029

Détail du produit anti-LRRC3 anticorps

Antigène: LRRC3 (Leucine Rich Repeat Containing 3 (LRRC3))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC3 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC3 antibody was raised against the middle region of LRRC3

Purification: Affinity purified

Immunogène: LRRC3 antibody was raised using the middle region of LRRC3 corresponding to a region with amino acids TFAGLAGGLRLLDLSYNRIQRIPKDALGKLSAKIRLSHNPLHCECALQEA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC3 Blocking Peptide, catalog no. 33R-9059, is also available for use as a blocking control in assays to test for specificity of this LRRC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC3

Antigène: LRRC3 (Leucine Rich Repeat Containing 3 (LRRC3))

Autre désignation: LRRC3 (LRRC3 Produits)

Synonymes: anticorps C21orf102, anticorps 1300011L04Rik, anticorps leucine rich repeat containing 3, anticorps LRRC3, anticorps Lrrc3

Sujet: The function of LRRC3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 25 kDa (MW of target protein)