C21orf58 anticorps (N-Term)

N° du produit ABIN633031

Détail du produit anti-C21orf58 anticorps

Antigène: C21orf58 (Chromosome 21 Open Reading Frame 58 (C21orf58))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C21orf58 est non-conjugé

Application: Western Blotting (WB)

Specificité: C21 orf58 antibody was raised against the N terminal of C21 rf58

Purification: Affinity purified

Immunogène: C21 orf58 antibody was raised using the N terminal of C21 rf58 corresponding to a region with amino acids MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C21orf58 Blocking Peptide, catalog no. 33R-5735, is also available for use as a blocking control in assays to test for specificity of this C21orf58 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 rf58 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C21orf58

Antigène: C21orf58 (Chromosome 21 Open Reading Frame 58 (C21orf58))

Autre désignation: C21orf58 (C21orf58 Produits)

Synonymes: anticorps chromosome 21 open reading frame 58, anticorps chromosome 7 C21orf58 homolog, anticorps C21orf58, anticorps C7H21orf58

Sujet: The function of Chromosome 21 ORF protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 35 kDa (MW of target protein)