FGL2 anticorps (Middle Region)

N° du produit ABIN633034

Détail du produit anti-FGL2 anticorps

Antigène: FGL2 (Fibrinogen-Like 2 (FGL2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGL2 est non-conjugé

Application: Western Blotting (WB)

Specificité: FGL2 antibody was raised against the middle region of FGL2

Purification: Affinity purified

Immunogène: FGL2 antibody was raised using the middle region of FGL2 corresponding to a region with amino acids WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGL2 Blocking Peptide, catalog no. 33R-10030, is also available for use as a blocking control in assays to test for specificity of this FGL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FGL2

Antigène: FGL2 (Fibrinogen-Like 2 (FGL2))

Autre désignation: FGL2 (FGL2 Produits)

Synonymes: anticorps FGL2, anticorps wu:fj83c10, anticorps zgc:136619, anticorps si:ch211-276e22.3, anticorps fibroleukin, anticorps T49, anticorps pT49, anticorps AI385601, anticorps musfiblp, anticorps fibrinogen like 2, anticorps fibrinogen like 2 L homeolog, anticorps fibrinogen-like 2a, anticorps fibrinogen-like 2, anticorps fibrinogen-like protein 2, anticorps FGL2, anticorps fgl2.L, anticorps fgl2a, anticorps Fgl2

Sujet: The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.

Poids moléculaire: 48 kDa (MW of target protein)