ATPAF1 anticorps (N-Term)

N° du produit ABIN633038

L’anticorps Lapin Polyclonal anti-ATPAF1 a été validé pour WB. Il convient pour détecter ATPAF1 dans des échantillons de Humain.

Aperçu rapide pour ATPAF1 anticorps (N-Term) (ABIN633038)

Antigène: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATPAF1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ATPAF1 anticorps

Épitope: N-Term

Specificité: ATPAF1 antibody was raised against the N terminal of ATPAF1

Purification: Affinity purified

Immunogène: ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATPAF1 Blocking Peptide, (ABIN938779), is also available for use as a blocking control in assays to test for specificity of this ATPAF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPAF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATPAF1

Antigène: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Autre désignation: ATPAF1

Sujet: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Poids moléculaire: 29 kDa (MW of target protein)