ATPAF1 anticorps (N-Term)

N° du produit ABIN633038

Détail du produit anti-ATPAF1 anticorps

Antigène: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATPAF1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATPAF1 antibody was raised against the N terminal of ATPAF1

Purification: Affinity purified

Immunogène: ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATPAF1 Blocking Peptide, catalog no. 33R-3393, is also available for use as a blocking control in assays to test for specificity of this ATPAF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATPAF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATPAF1

Antigène: ATPAF1 (ATP Synthase Mitochondrial F1 Complex Assembly Factor 1 (ATPAF1))

Autre désignation: ATPAF1 (ATPAF1 Produits)

Synonymes: anticorps ATPAF1, anticorps T14G11.17, anticorps T14G11_17, anticorps ATP11, anticorps ATP11p, anticorps 6330547J17Rik, anticorps AI593252, anticorps id:ibd1136, anticorps si:dkey-171o17.2, anticorps zgc:110583, anticorps ATP synthase mitochondrial F1 complex assembly factor 1, anticorps ATP synthase F1 complex assembly factor, anticorps Atpaf1, anticorps ATPAF1, anticorps AT2G34050, anticorps atpaf1

Sujet: This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.

Poids moléculaire: 29 kDa (MW of target protein)