KLHL2 anticorps

N° du produit ABIN633041

Détail du produit anti-KLHL2 anticorps

Antigène: KLHL2 (Kelch-Like 2, Mayven (KLHL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KLHL2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLHL2 Blocking Peptide, catalog no. 33R-9385, is also available for use as a blocking control in assays to test for specificity of this KLHL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLHL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KLHL2

Antigène: KLHL2 (Kelch-Like 2, Mayven (KLHL2))

Autre désignation: KLHL2 (KLHL2 Produits)

Synonymes: anticorps 6030411N21Rik, anticorps ABP-KELCH, anticorps AU020744, anticorps Mav, anticorps mKIAA4249, anticorps MAV, anticorps MAYVEN, anticorps kelch-like family member 2, anticorps kelch like family member 2, anticorps kelch-like 2, Mayven, anticorps Klhl2, anticorps KLHL2

Sujet: KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells.

Poids moléculaire: 66 kDa (MW of target protein)