SULT1E1 anticorps (Middle Region)

N° du produit ABIN633046

Cet anticorps Lapin Polyclonal détecte spécifiquement SULT1E1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour SULT1E1 anticorps (Middle Region) (ABIN633046)

Antigène: SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SULT1E1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SULT1E1 anticorps

Épitope: Middle Region

Specificité: SULT1 E1 antibody was raised against the middle region of SULT1 1

Purification: Affinity purified

Immunogène: SULT1 E1 antibody was raised using the middle region of SULT1 1 corresponding to a region with amino acids LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SULT1E1 Blocking Peptide, (ABIN5616455), is also available for use as a blocking control in assays to test for specificity of this SULT1E1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SULT1E1

Antigène: SULT1E1 (Sulfotransferase Family 1E Member 1 (SULT1E1))

Autre désignation: SULT1E1

Sujet: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis