SCG2 anticorps

N° du produit ABIN633054

Cet anticorps anti-SCG2 Polyclonal Lapin (ABIN633054) détecte spécifiquement SCG2 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SCG2 anticorps (ABIN633054)

Antigène: SCG2 (Secretogranin II (SCG2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCG2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SCG2 anticorps

Purification: Affinity purified

Immunogène: SCG2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEESSPDYNPYQGVSVPLQQKENGDESHLPERDSLSEEDWMRIILEALRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCG2 Blocking Peptide, (ABIN939716), is also available for use as a blocking control in assays to test for specificity of this SCG2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCG2

Antigène: SCG2 (Secretogranin II (SCG2))

Autre désignation: SCG2

Sujet: The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. Studies in rodents suggest that the full-length protein, secretogranin II, is involved in the packaging or sorting of peptide hormones and neuropeptides into secretory vesicles. The full-length protein is cleaved to produce the active peptide secretoneurin, which exerts chemotaxic effects on specific cell types, and EM66, whose function is unknown.

Poids moléculaire: 71 kDa (MW of target protein)