UGGT1 anticorps (Middle Region)

N° du produit ABIN633063

Cet anticorps anti-UGGT1 est un anticorps Lapin Polyclonal détectant UGGT1 dans WB. Adapté pour Humain.

Aperçu rapide pour UGGT1 anticorps (Middle Region) (ABIN633063)

Antigène: UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGGT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UGGT1 anticorps

Épitope: Middle Region

Specificité: UGCGL1 antibody was raised against the middle region of µgCGL1

Purification: Affinity purified

Immunogène: UGCGL1 antibody was raised using the middle region of µgCGL1 corresponding to a region with amino acids AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGCGL1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this µgCGL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGGT1

Antigène: UGGT1 (UDP-Glucose Glycoprotein Glucosyltransferase 1 (UGGT1))

Autre désignation: UGCGL1

Sujet: UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.

Poids moléculaire: 175 kDa (MW of target protein)

Pathways: Activation of Innate immune Response