CHMP4B anticorps (Middle Region)
-
- Antigène Voir toutes CHMP4B Anticorps
- CHMP4B (Charged Multivesicular Body Protein 4B (CHMP4B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CHMP4B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CHMP4 B antibody was raised against the middle region of CHMP4
- Purification
- Affinity purified
- Immunogène
- CHMP4 B antibody was raised using the middle region of CHMP4 corresponding to a region with amino acids RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
- Top Product
- Discover our top product CHMP4B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CHMP4B Blocking Peptide, catalog no. 33R-8000, is also available for use as a blocking control in assays to test for specificity of this CHMP4B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHMP0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CHMP4B (Charged Multivesicular Body Protein 4B (CHMP4B))
- Autre désignation
- CHMP4B (CHMP4B Produits)
- Synonymes
- anticorps C20orf178, anticorps CHMP4A, anticorps CTPP3, anticorps CTRCT31, anticorps SNF7, anticorps SNF7-2, anticorps Shax1, anticorps VPS32B, anticorps Vps32-2, anticorps dJ553F4.4, anticorps 2010012F05Rik, anticorps C76846, anticorps Snf7-2, anticorps RGD1309846, anticorps RGD1565889, anticorps CHMP4b, anticorps chmp4b, anticorps chmp4b.S, anticorps CHMP4c, anticorps c20orf178, anticorps wu:fc96b02, anticorps zgc:55566, anticorps charged multivesicular body protein 4B, anticorps charged multivesicular body protein 4Ba, anticorps charged multivesicular body protein 4B L homeolog, anticorps charged multivesicular body protein 4Bb, anticorps CHMP4B, anticorps Chmp4b, anticorps chmp4ba, anticorps chmp4b.L, anticorps chmp4bb
- Sujet
- This gene encodes a member of the chromatin-modifying protein/charged multivesicular body protein (CHMP) protein family. The protein is part of the endosomal sorting complex required for transport (ESCRT) complex III (ESCRT-III), which functions in the sorting of endocytosed cell-surface receptors into multivesicular endosomes. The ESCRT machinery also functions in the final abscisson stage of cytokinesis and in the budding of enveloped viruses such as HIV-1. The three proteins of the CHMP4 subfamily interact with programmed cell death 6 interacting protein (PDCD6IP, also known as ALIX), which also functions in the ESCRT pathway. The CHMP4 proteins assemble into membrane-attached 5-nm filaments that form circular scaffolds and promote or stabilize outward budding. These polymers are proposed to help generate the luminal vesicles of multivesicular bodies. Mutations in this gene result in autosomal dominant posterior polar cataracts.
- Poids moléculaire
- 25 kDa (MW of target protein)
-