RAB39 anticorps (N-Term)

N° du produit ABIN633072

Cet anticorps anti-RAB39 est un anticorps Lapin Polyclonal détectant RAB39 dans WB. Adapté pour Humain.

Aperçu rapide pour RAB39 anticorps (N-Term) (ABIN633072)

Antigène: RAB39 (RAB39, Member RAS Oncogene Family (RAB39))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB39 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAB39 anticorps

Épitope: N-Term

Specificité: RAB39 antibody was raised against the N terminal of RAB39

Purification: Affinity purified

Immunogène: RAB39 antibody was raised using the N terminal of RAB39 corresponding to a region with amino acids METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB39 Blocking Peptide, (ABIN5615708), is also available for use as a blocking control in assays to test for specificity of this RAB39 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB39 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB39

Antigène: RAB39 (RAB39, Member RAS Oncogene Family (RAB39))

Autre désignation: RAB39

Sujet: RAB39 may be involved in vesicular trafficking.

Poids moléculaire: 25 kDa (MW of target protein)