RABEPK anticorps (N-Term)

N° du produit ABIN633075

Détail du produit anti-RABEPK anticorps

Antigène: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RABEPK est non-conjugé

Application: Western Blotting (WB)

Specificité: RABEPK antibody was raised against the N terminal of RABEPK

Purification: Affinity purified

Immunogène: RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RABEPK Blocking Peptide, catalog no. 33R-6159, is also available for use as a blocking control in assays to test for specificity of this RABEPK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABEPK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RABEPK

Antigène: RABEPK (Rab9 Effector Protein with Kelch Motifs (RABEPK))

Autre désignation: RABEPK (RABEPK Produits)

Synonymes: anticorps RAB9P40, anticorps bA65N13.1, anticorps p40, anticorps 8430412M01Rik, anticorps 9530020D24Rik, anticorps AV073337, anticorps C87311, anticorps Rab9p40, anticorps 9530020d24rik, anticorps RGD1310612, anticorps Rab9 effector protein with kelch motifs, anticorps Rab9 effector protein with kelch motifs L homeolog, anticorps RABEPK, anticorps Rabepk, anticorps rabepk.L, anticorps rabepk

Sujet: RABEPK is a rab9 effector required for endosome to trans-Golgi network (TGN) transport.

Poids moléculaire: 40 kDa (MW of target protein)