TUBB4 anticorps (N-Term)

N° du produit ABIN633077

L’anticorps Lapin Polyclonal anti-TUBB4 a été validé pour WB. Il convient pour détecter TUBB4 dans des échantillons de Humain.

Aperçu rapide pour TUBB4 anticorps (N-Term) (ABIN633077)

Antigène: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TUBB4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TUBB4 anticorps

Épitope: N-Term

Specificité: Beta Tubulin 4 antibody was raised against the N terminal of TUBB4

Purification: Affinity purified

Immunogène: Beta Tubulin 4 antibody was raised using the N terminal of TUBB4 corresponding to a region with amino acids TYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLEPGTMDSVRSGPFGQI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Beta Tubulin 4 Blocking Peptide, (ABIN5612324), is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUBB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TUBB4

Antigène: TUBB4 (TUBB4A) (Tubulin beta 4a (TUBB4A))

Sujet: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

Poids moléculaire: 49 kDa (MW of target protein)