RAB11FIP2 anticorps

N° du produit ABIN633082

Détail du produit anti-RAB11FIP2 anticorps

Antigène: RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB11FIP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RAB11 FIP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIQGSPEKYILFLIVMHRSLVGLDKFLGQVAINLNDIFEDKQRRKTEWF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB11FIP2 Blocking Peptide, catalog no. 33R-5150, is also available for use as a blocking control in assays to test for specificity of this RAB11FIP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 IP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB11FIP2

Antigène: RAB11FIP2 (RAB11 Family Interacting Protein 2 (Class I) (RAB11FIP2))

Autre désignation: RAB11FIP2 (RAB11FIP2 Produits)

Synonymes: anticorps RGD1308538, anticorps Rab11-FIP2, anticorps nRip11, anticorps 4930470G04Rik, anticorps A830046J09Rik, anticorps AW558126, anticorps Nrip11, anticorps RAB11 family interacting protein 2, anticorps RAB11 family interacting protein 2 (class I), anticorps Rab11fip2, anticorps RAB11FIP2

Sujet: RAB11FIP2 is a Rab11 effector protein acting in the regulation of the transport of vesicles from the endosomal recycling compartment (ERC) to the plasma membrane.RAB11FIP2 is also involved in receptor-mediated endocytosis and membrane trafficking of recycling endosomes, probably originating from clathrin-coated vesicles. Binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and phosphatidic acid (PA).

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis