Ensa anticorps (N-Term)

N° du produit ABIN633083

Détail du produit anti-Ensa anticorps

Antigène: Ensa (ENSA) (Endosulfine alpha (ENSA))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ensa est non-conjugé

Application: Western Blotting (WB)

Specificité: ENSA antibody was raised against the N terminal of ENSA

Purification: Affinity purified

Immunogène: ENSA antibody was raised using the N terminal of ENSA corresponding to a region with amino acids MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ENSA Blocking Peptide, catalog no. 33R-5662, is also available for use as a blocking control in assays to test for specificity of this ENSA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENSA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ensa

Antigène: Ensa (ENSA) (Endosulfine alpha (ENSA))

Autre désignation: ENSA (ENSA Produits)

Synonymes: anticorps ARPP-19e, anticorps 1700020C18Rik, anticorps 2610007F17Rik, anticorps AI451924, anticorps ensa, anticorps si:dkeyp-24a7.3, anticorps ensaa, anticorps endosulfine alpha, anticorps endosulfine alpha a, anticorps endosulfine alpha S homeolog, anticorps ENSA, anticorps Ensa, anticorps ensa, anticorps ensaa, anticorps ensa.S

Sujet: The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.

Poids moléculaire: 12 kDa (MW of target protein)