LRG1 anticorps (N-Term)

N° du produit ABIN633085

Détail du produit anti-LRG1 anticorps

Antigène: LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRG1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRG1 antibody was raised against the N terminal of LRG1

Purification: Affinity purified

Immunogène: LRG1 antibody was raised using the N terminal of LRG1 corresponding to a region with amino acids GVTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRG1 Blocking Peptide, catalog no. 33R-3657, is also available for use as a blocking control in assays to test for specificity of this LRG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRG1

Antigène: LRG1 (Leucine-Rich alpha-2 Glycoprotein 1 (LRG1))

Autre désignation: LRG1 (LRG1 Produits)

Synonymes: anticorps lrg, anticorps HMFT1766, anticorps LRG, anticorps 1300008B03Rik, anticorps 2310031E04Rik, anticorps Lrg, anticorps Lrhg, anticorps si:dkey-90m5.4, anticorps leucine rich alpha-2-glycoprotein 1, anticorps leucine-rich alpha-2-glycoprotein 1 L homeolog, anticorps leucine-rich alpha-2-glycoprotein 1, anticorps perilipin-5, anticorps si:dkey-90m5.4, anticorps LRG1, anticorps lrg1.L, anticorps Lrg1, anticorps PLIN5

Sujet: The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation