Neuronatin (NNAT) (Middle Region) anticorps

N° du produit ABIN633088

Détail du produit

Antigène: Neuronatin (NNAT)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: NNAT antibody was raised against the middle region of NNAT

Purification: Affinity purified

Immunogène: NNAT antibody was raised using the middle region of NNAT corresponding to a region with amino acids MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NNAT Blocking Peptide, catalog no. 33R-5614, is also available for use as a blocking control in assays to test for specificity of this NNAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Neuronatin (NNAT)

Autre désignation: NNAT (NNAT Produits)

Synonymes: anticorps Peg5, anticorps 5730414I02Rik, anticorps AW107673, anticorps neuronatin, anticorps NNAT, anticorps Nnat

Sujet: The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele. Two transcript variants encoding two different isoforms have been found for this gene.

Poids moléculaire: 6 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion