IFN beta 1 (Middle Region) anticorps

N° du produit ABIN633094

Cet anticorps Lapin Polyclonal détecte spécifiquement IFN beta 1 dans WB. Il présente une réactivité avec des échantillons de Humain.Il a été cité dans 1 publication.

Aperçu rapide pour IFN beta 1 (Middle Region) anticorps (ABIN633094)

Antigène: IFN beta 1

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Détail du produit

Épitope: Middle Region

Specificité: IFN Beta 1 antibody was raised against the middle region of IFNB1

Purification: Affinity purified

Immunogène: IFN Beta 1 antibody was raised using the middle region of IFNB1 corresponding to a region with amino acids NLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFN Beta 1 Blocking Peptide, (ABIN5614147), is also available for use as a blocking control in assays to test for specificity of this IFN Beta 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Référence

Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." dans: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

Détail du antigène

Antigène: IFN beta 1

Sujet: IFNB1 has antiviral, antibacterial and anticancer activities.

Poids moléculaire: 22 kDa (MW of target protein)