CRP anticorps (N-Term)

N° du produit ABIN633100

Détail du produit anti-CRP anticorps

Antigène: CRP (C-Reactive Protein (CRP))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CRP est non-conjugé

Application: Western Blotting (WB)

Specificité: CRP antibody was raised against the N terminal of CRP

Purification: Affinity purified

Immunogène: CRP antibody was raised using the N terminal of CRP corresponding to a region with amino acids MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CRP Blocking Peptide, catalog no. 33R-5929, is also available for use as a blocking control in assays to test for specificity of this CRP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CRP

Antigène: CRP (C-Reactive Protein (CRP))

Autre désignation: C-Reactive Protein (CRP Produits)

Synonymes: anticorps PTX1, anticorps crp, anticorps AI255847, anticorps Aa1249, anticorps Ab1-341, anticorps Ab2-196, anticorps Ac1-114, anticorps Ac1262, anticorps Ac2-069, anticorps Ba2-693, anticorps APCS, anticorps 0610010I23Rik, anticorps AW743261, anticorps C77570, anticorps CRP2, anticorps CRP4, anticorps Crp, anticorps ESP1, anticorps Hlp, anticorps CRP5.1, anticorps zgc:152809, anticorps C-reactive protein, anticorps C-reactive protein, pentraxin-related, anticorps c-reactive protein, pentraxin-related, anticorps cysteine rich protein 2, anticorps CRP, anticorps crp, anticorps Crp, anticorps Crip2, anticorps LOC776376

Sujet: The protein encoded by this gene belongs to the pentaxin family. It is involved in several host defense related functions based on its ability to recognise foreign pathogens and damaged cells of the host and to initiate their elimination by interacting with humoral and cellular effector systems in the blood. Consequently, the level of this protein in plasma increases greatly during acute phase response to tissue injury, infection, or other inflammatory stimuli.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Carbohydrate Homeostasis