COX7B anticorps (N-Term)

N° du produit ABIN633101

Détail du produit anti-COX7B anticorps

Antigène: COX7B (Cytochrome C Oxidase Subunit VIIb (COX7B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COX7B est non-conjugé

Application: Western Blotting (WB)

Specificité: COX7 B antibody was raised against the N terminal of COX7

Purification: Affinity purified

Immunogène: COX7 B antibody was raised using the N terminal of COX7 corresponding to a region with amino acids MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COX7B Blocking Peptide, catalog no. 33R-6000, is also available for use as a blocking control in assays to test for specificity of this COX7B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COX7B

Antigène: COX7B (Cytochrome C Oxidase Subunit VIIb (COX7B))

Autre désignation: COX7B (COX7B Produits)

Synonymes: anticorps APLCC, anticorps 1100001F07Rik, anticorps 1110004F07Rik, anticorps C80563, anticorps MGC86432, anticorps MGC147245, anticorps fk47c09, anticorps wu:fk47c09, anticorps zgc:194876, anticorps IHQ, anticorps cytochrome c oxidase subunit 7B, anticorps cytochrome c oxidase subunit VIIb, anticorps cytochrome c oxidase subunit VIIb L homeolog, anticorps COX7B, anticorps Cox7b, anticorps cox7b.L, anticorps cox7b

Sujet: Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIb, which is highly similar to bovine COX VIIb protein and is found in all tissues. This gene may have several pseudogenes on chromosomes 1, 2, 20 and 22, respectively.

Poids moléculaire: 6 kDa (MW of target protein)

Pathways: Proton Transport