Otospiralin anticorps (N-Term)

N° du produit ABIN633104

Détail du produit anti-Otospiralin anticorps

Antigène: Otospiralin (OTOS)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Otospiralin est non-conjugé

Application: Western Blotting (WB)

Specificité: Otospiralin antibody was raised against the N terminal of OTOS

Purification: Affinity purified

Immunogène: Otospiralin antibody was raised using the N terminal of OTOS corresponding to a region with amino acids MQACMVPGLALCLLLGPLAGAKPVQEEGDPYAELPAMPYWPFSTSDFWNY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Otospiralin Blocking Peptide, catalog no. 33R-6316, is also available for use as a blocking control in assays to test for specificity of this Otospiralin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTOS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Otospiralin

Antigène: Otospiralin (OTOS)

Autre désignation: Otospiralin (OTOS Produits)

Synonymes: anticorps otosb, anticorps otosp, anticorps MGC85248, anticorps otos, anticorps otosa, anticorps MGC148549, anticorps OTOSP, anticorps otospiralin L homeolog, anticorps otospiralin, anticorps otospiralin S homeolog, anticorps otos.L, anticorps OTOS, anticorps otos.S, anticorps otos, anticorps Otos

Sujet: OTOS may be essential for the survival of the neurosensory epithelium of the inner ear.

Poids moléculaire: 10 kDa (MW of target protein)

Pathways: Sensory Perception of Sound