Glycerol Kinase anticorps (Middle Region)

N° du produit ABIN633106

Cet anticorps Lapin Polyclonal détecte spécifiquement Glycerol Kinase dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour Glycerol Kinase anticorps (Middle Region) (ABIN633106)

Antigène: Glycerol Kinase (GK)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glycerol Kinase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Glycerol Kinase anticorps

Épitope: Middle Region

Specificité: GK antibody was raised against the middle region of GK

Purification: Affinity purified

Immunogène: GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GK Blocking Peptide, (ABIN5613776), is also available for use as a blocking control in assays to test for specificity of this GK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glycerol Kinase

Antigène: Glycerol Kinase (GK)

Autre désignation: GK

Sujet: The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GkDa). Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 58 kDa (MW of target protein)