Glycerol Kinase anticorps (Middle Region)

N° du produit ABIN633106

Détail du produit anti-Glycerol Kinase anticorps

Antigène: Glycerol Kinase (GK)

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glycerol Kinase est non-conjugé

Application: Western Blotting (WB)

Specificité: GK antibody was raised against the middle region of GK

Purification: Affinity purified

Immunogène: GK antibody was raised using the middle region of GK corresponding to a region with amino acids MAAGAAEGVGVWSLEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GK Blocking Peptide, catalog no. 33R-5595, is also available for use as a blocking control in assays to test for specificity of this GK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glycerol Kinase

Antigène: Glycerol Kinase (GK)

Autre désignation: GK (GK Produits)

Synonymes: anticorps GK1, anticorps GKD, anticorps D930012N15Rik, anticorps GK, anticorps CG18374, anticorps Dmel\\CG18374, anticorps dGyk, anticorps ASTP, anticorps Gyk, anticorps gk1, anticorps gk2, anticorps gkd, anticorps gyk, anticorps Gk, anticorps BmGK, anticorps DKFZp469P1225, anticorps glycerol kinase, anticorps Glycerol kinase 1, anticorps glycerol kinase S homeolog, anticorps putative glycerol kinase 3, anticorps ATP:glycerol 3-phosphotransferase; glycerokinase; GK, anticorps Glycerol kinase, anticorps Fanconi anemia core complex associated protein 100, anticorps GK, anticorps Gk, anticorps Gk1, anticorps gk.S, anticorps LOC705001, anticorps glpK, anticorps Spico_1557, anticorps Trebr_0397, anticorps Halhy_5315, anticorps gk, anticorps FAAP100

Sujet: The product of this gene belongs to the FGGY kinase family of proteins and encodes glycerol kinase. Glycerol kinase is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. Defects in this gene are the cause of glycerol kinase deficiency (GkDa). Alternatively spliced transcript variants encoding different isoforms have been identified.

Poids moléculaire: 58 kDa (MW of target protein)